Lineage for d1vd3a_ (1vd3 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1039774Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
    alpha+beta fold
  4. 1039775Superfamily d.124.1: Ribonuclease Rh-like [55895] (1 family) (S)
  5. 1039776Family d.124.1.1: Ribonuclease Rh-like [55896] (9 proteins)
  6. 1039812Protein automated matches [190794] (1 species)
    not a true protein
  7. 1039813Species Nicotiana glutinosa [TaxId:35889] [188052] (3 PDB entries)
  8. 1039814Domain d1vd3a_: 1vd3 A: [161849]
    automated match to d1iyba_
    protein/RNA complex; complexed with u2p

Details for d1vd3a_

PDB Entry: 1vd3 (more details), 1.8 Å

PDB Description: Ribonuclease NT in complex with 2'-UMP
PDB Compounds: (A:) RNase NGR3

SCOPe Domain Sequences for d1vd3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vd3a_ d.124.1.1 (A:) automated matches {Nicotiana glutinosa [TaxId: 35889]}
aqdfdffyfvqqwpasycdtrrsccypttgkpdedfsihglwpnyengkwpqncdressl
deseisdlistmeknwpslacpssdgvrfwshewlkhgtcsalgerayfqaaldfrkksn
llenlknaeitprngehytlesikkaieegvghspyiecnvdtqgnhqiyqvylcvdkta
tdfidcpifphgrgcgskiefppf

SCOPe Domain Coordinates for d1vd3a_:

Click to download the PDB-style file with coordinates for d1vd3a_.
(The format of our PDB-style files is described here.)

Timeline for d1vd3a_: