Lineage for d1vd1a_ (1vd1 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974241Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
    alpha+beta fold
  4. 2974242Superfamily d.124.1: Ribonuclease Rh-like [55895] (2 families) (S)
  5. 2974243Family d.124.1.1: Ribonuclease Rh-like [55896] (9 proteins)
  6. 2974279Protein automated matches [190794] (1 species)
    not a true protein
  7. 2974280Species Nicotiana glutinosa [TaxId:35889] [188052] (3 PDB entries)
  8. 2974283Domain d1vd1a_: 1vd1 A: [161848]
    automated match to d1iyba_
    protein/RNA complex; complexed with amp

Details for d1vd1a_

PDB Entry: 1vd1 (more details), 1.8 Å

PDB Description: Crystal structure of RNase NT in complex with 5'-AMP
PDB Compounds: (A:) RNase NGR3

SCOPe Domain Sequences for d1vd1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vd1a_ d.124.1.1 (A:) automated matches {Nicotiana glutinosa [TaxId: 35889]}
qdfdffyfvqqwpasycdtrrsccypttgkpdedfsihglwpnyengkwpqncdressld
eseisdlistmeknwpslacpssdgvrfwshewlkhgtcsalgerayfqaaldfrkksnl
lenlknaeitprngehytlesikkaieegvghspyiecnvdtqgnhqiyqvylcvdktat
dfidcpifphgrgcgskiefppf

SCOPe Domain Coordinates for d1vd1a_:

Click to download the PDB-style file with coordinates for d1vd1a_.
(The format of our PDB-style files is described here.)

Timeline for d1vd1a_: