SCOPe 2.01: Domain d1vcza_: 1vcz A:

Lineage for d1vcza_ (1vcz A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
   alpha+beta fold

4. Superfamily d.124.1: Ribonuclease Rh-like [55895] (1 family)

5. Family d.124.1.1: Ribonuclease Rh-like [55896] (9 proteins)

6. Protein automated matches [190794] (1 species)
   not a true protein

7. Species Nicotiana glutinosa [TaxId:35889] [188052] (3 PDB entries)

8. Domain d1vcza_: 1vcz A: [161847]
   automated match to d1iyba_
   complexed with 5gp

Details for d1vcza_

PDB Entry: 1vcz, 1.8 Å

PDB Description: Crystal structure of the RNase NT in complex with 5'-GMP

PDB Compounds: (A:) RNase NGR3

SCOPe Domain Sequences for d1vcza_:

Sequence; same for both SEQRES and ATOM records:

>d1vcza_ d.124.1.1 (A:) automated matches {Nicotiana glutinosa [TaxId: 35889]}
aqdfdffyfvqqwpasycdtrrsccypttgkpdedfsihglwpnyengkwpqncdressl
deseisdlistmeknwpslacpssdgvrfwshewlkhgtcsalgerayfqaaldfrkksn
llenlknaeitprngehytlesikkaieegvghspyiecnvdtqgnhqiyqvylcvdkta
tdfidcpifphgrgcgskiefppf

Timeline for d1vcza_:

• d1vcza_ is new in SCOPe 2.01-stable
  
• d1vcza_ appears in SCOPe 2.02
  
• d1vcza_ appears in the current release, SCOPe 2.08