Lineage for d1vbwa_ (1vbw A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1902783Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. 1902784Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. 1902785Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
    automatically mapped to Pfam PF00280
  6. 1902838Protein automated matches [190792] (2 species)
    not a true protein
  7. 1902839Species Bitter gourd (Momordica charantia) [TaxId:3673] [188049] (1 PDB entry)
  8. 1902840Domain d1vbwa_: 1vbw A: [161846]
    automated match to d1tina_
    complexed with k, na, tla

Details for d1vbwa_

PDB Entry: 1vbw (more details), 0.93 Å

PDB Description: Crystal Structure of Bitter Gourd Trypsin Inhibitor
PDB Compounds: (A:) trypsin inhibitor BGIT

SCOPe Domain Sequences for d1vbwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbwa_ d.40.1.1 (A:) automated matches {Bitter gourd (Momordica charantia) [TaxId: 3673]}
srcqgksswpqlvgstgaaakavierenprvraviikvgsgatkdfrcdrvrvwvtergi
varpptig

SCOPe Domain Coordinates for d1vbwa_:

Click to download the PDB-style file with coordinates for d1vbwa_.
(The format of our PDB-style files is described here.)

Timeline for d1vbwa_: