![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily) alpha+beta sandwich; loop across free side of beta-sheet |
![]() | Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) ![]() |
![]() | Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins) automatically mapped to Pfam PF00280 |
![]() | Protein automated matches [190792] (4 species) not a true protein |
![]() | Species Bitter gourd (Momordica charantia) [TaxId:3673] [188049] (1 PDB entry) |
![]() | Domain d1vbwa_: 1vbw A: [161846] automated match to d1tina_ complexed with k, na, tla |
PDB Entry: 1vbw (more details), 0.93 Å
SCOPe Domain Sequences for d1vbwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vbwa_ d.40.1.1 (A:) automated matches {Bitter gourd (Momordica charantia) [TaxId: 3673]} srcqgksswpqlvgstgaaakavierenprvraviikvgsgatkdfrcdrvrvwvtergi varpptig
Timeline for d1vbwa_: