Lineage for d1vbna_ (1vbn A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2468310Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2468547Protein automated matches [190581] (10 species)
    not a true protein
  7. 2468554Species Escherichia coli [TaxId:562] [188048] (4 PDB entries)
  8. 2468560Domain d1vbna_: 1vbn A: [161844]
    automated match to d1tyae_
    protein/RNA complex; complexed with ysa; mutant

Details for d1vbna_

PDB Entry: 1vbn (more details), 2.7 Å

PDB Description: escherichia coli tyrosyl-trna synthetase mutant complexed with tyr-ams
PDB Compounds: (A:) Tyrosyl-tRNA synthetase

SCOPe Domain Sequences for d1vbna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbna_ c.26.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
nlikqlqerglvaqvtdeealaerlaqgpialvcgfdptadslhlghlvpllclkrfqqa
ghkpvalvggatgligdpsfkaaerklnteetvqewvdkirkqvapfldfdcgensaiaa
nnydwfgnmnvltflrdigkhfsvnqminkeavkqrlnredqgisftefsynllqgydfa
clnkqygvvlciggsdqwgnitsgidltrrlhqnqvfgltvplitkadgtkfgkteggav
wldpkktspykfyqfwintadadvyrflkfftfmsieeinaleeedknsgkapraqyvla
eqvtrlvhgeeglqaakr

SCOPe Domain Coordinates for d1vbna_:

Click to download the PDB-style file with coordinates for d1vbna_.
(The format of our PDB-style files is described here.)

Timeline for d1vbna_: