Lineage for d1vbmb_ (1vbm B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1841352Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1841353Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 1841582Protein automated matches [190581] (8 species)
    not a true protein
  7. 1841586Species Escherichia coli [TaxId:562] [188048] (3 PDB entries)
  8. 1841591Domain d1vbmb_: 1vbm B: [161843]
    automated match to d1tyae_
    protein/RNA complex; complexed with so4, ysa

Details for d1vbmb_

PDB Entry: 1vbm (more details), 2.7 Å

PDB Description: Crystal structure of the Escherichia coli tyrosyl-tRNA synthetase complexed with Tyr-AMS
PDB Compounds: (B:) Tyrosyl-tRNA synthetase

SCOPe Domain Sequences for d1vbmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbmb_ c.26.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
nlikqlqerglvaqvtdeealaerlaqgpialycgfdptadslhlghlvpllclkrfqqa
ghkpvalvggatgligdpsfkaaerklnteetvqewvdkirkqvapfldfdcgensaiaa
nnydwfgnmnvltflrdigkhfsvnqminkeavkqrlnredqgisftefsynllqgydfa
clnkqygvvlqiggsdqwgnitsgidltrrlhqnqvfgltvplitkadgtkfgkteggav
wldpkktspykfyqfwintadadvyrflkfftfmsieeinaleeedknsgkapraqyvla
eqvtrlvhgeeglqaakr

SCOPe Domain Coordinates for d1vbmb_:

Click to download the PDB-style file with coordinates for d1vbmb_.
(The format of our PDB-style files is described here.)

Timeline for d1vbmb_: