Lineage for d1vbja1 (1vbj A:1-276)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829136Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2829673Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2829674Protein automated matches [190793] (31 species)
    not a true protein
  7. 2829815Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188050] (1 PDB entry)
  8. 2829816Domain d1vbja1: 1vbj A:1-276 [161839]
    Other proteins in same PDB: d1vbja2, d1vbjb2
    automated match to d1vp5a_
    complexed with cit, nap

Details for d1vbja1

PDB Entry: 1vbj (more details), 2.1 Å

PDB Description: the crystal structure of prostaglandin f synthase from trypanosoma brucei
PDB Compounds: (A:) prostaglandin F synthase

SCOPe Domain Sequences for d1vbja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbja1 c.1.7.0 (A:1-276) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
maltqslklsngvmmpvlgfgmwklqdgneaetatmwaiksgyrhidtaaiykneesagr
aiascgvpreelfvttklwnsdqgyestlsafeksikklgleyvdlylihwpgkdkfidt
wkafeklyadkkvraigvsnfhehhieellkhckvapmvnqielhpllnqkalceycksk
niavtawsplgqghlvedarlkaiggkygktaaqvmlrweiqagvitipksgneariken
gnifdfeltaediqvidgmnaghrygpdpevfmndf

SCOPe Domain Coordinates for d1vbja1:

Click to download the PDB-style file with coordinates for d1vbja1.
(The format of our PDB-style files is described here.)

Timeline for d1vbja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vbja2