Lineage for d1v94a_ (1v94 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. Protein automated matches [190603] (25 species)
    not a true protein
  7. Species Aeropyrum pernix [TaxId:56636] [188025] (3 PDB entries)
  8. Domain d1v94a_: 1v94 A: [161837]
    automated match to d1hqsa_

Details for d1v94a_

PDB Entry: 1v94 (more details), 2.28 Å

PDB Description: Crystal structure of isocitrate dehydrogenase from Aeropyrum pernix
PDB Compounds: (A:) isocitrate dehydrogenase

SCOPe Domain Sequences for d1v94a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v94a_ c.77.1.0 (A:) automated matches {Aeropyrum pernix [TaxId: 56636]}
ppctteelspppggslveysggslrvpdnpvvafirgdgvgpevvesalkvvdaavkkvy
ggsrrivwwellaghlarekcgellpkatlegirlarvalkgpletpvgtgyrslnvair
qaldlyanirpvryygqpaphkyadrvdmvifrentedvyagiewphdspeaarirrfla
eefgisiredagigvkpisrfatrrlmeralewalrngntvvtimhkgnimkytegafmr
wayevalekfrehvvteqevqekyggvrpegkilvndriadnmlqqiitrpwdyqvivap
nlngdyisdaasalvggigmaagmnmgdgiavaepvhgtapkyagkdlinpsaeilsasl
ligefmgwrevksiveyairkavqskkvtqdlarhmpgvqplrtseytetliayideadl
nevlagkrg

SCOPe Domain Coordinates for d1v94a_ are not available.

Timeline for d1v94a_:

Domains from other chains:
(mouse over for more information)
d1v94b_