Lineage for d1if1a_ (1if1 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 351236Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 351617Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families) (S)
    contains a small beta-sheet (wing)
  5. 351904Family a.4.5.23: Interferon regulatory factor [46877] (2 proteins)
  6. 351905Protein Interferon regulatory factor 1 (IRF-1) [46878] (1 species)
  7. 351906Species Mouse (Mus musculus) [TaxId:10090] [46879] (1 PDB entry)
  8. 351907Domain d1if1a_: 1if1 A: [16183]

Details for d1if1a_

PDB Entry: 1if1 (more details), 3 Å

PDB Description: interferon regulatory factor 1 (irf-1) complex with dna

SCOP Domain Sequences for d1if1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1if1a_ a.4.5.23 (A:) Interferon regulatory factor 1 (IRF-1) {Mouse (Mus musculus)}
rmrpwlemqinsnqipgliwinkeemifqipwkhaakhgwdinkdaclfrswaihtgryk
agekepdpktwkanfrcamnslpdieevkdqsrnkgssavrvyrm

SCOP Domain Coordinates for d1if1a_:

Click to download the PDB-style file with coordinates for d1if1a_.
(The format of our PDB-style files is described here.)

Timeline for d1if1a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1if1b_