Lineage for d1if1a_ (1if1 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693544Family a.4.5.23: Interferon regulatory factor [46877] (4 proteins)
    Pfam PF00605
  6. 2693545Protein Interferon regulatory factor 1 (IRF-1) [46878] (1 species)
  7. 2693546Species Mouse (Mus musculus) [TaxId:10090] [46879] (1 PDB entry)
  8. 2693547Domain d1if1a_: 1if1 A: [16183]
    protein/DNA complex

Details for d1if1a_

PDB Entry: 1if1 (more details), 3 Å

PDB Description: interferon regulatory factor 1 (irf-1) complex with dna
PDB Compounds: (A:) protein (interferon regulatory factor 1)

SCOPe Domain Sequences for d1if1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1if1a_ a.4.5.23 (A:) Interferon regulatory factor 1 (IRF-1) {Mouse (Mus musculus) [TaxId: 10090]}
rmrpwlemqinsnqipgliwinkeemifqipwkhaakhgwdinkdaclfrswaihtgryk
agekepdpktwkanfrcamnslpdieevkdqsrnkgssavrvyrm

SCOPe Domain Coordinates for d1if1a_:

Click to download the PDB-style file with coordinates for d1if1a_.
(The format of our PDB-style files is described here.)

Timeline for d1if1a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1if1b_