Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) the constituent families form similar dimers |
Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins) the active site is between the two identical subunits |
Protein automated matches [190072] (15 species) not a true protein |
Species Bacillus coagulans [TaxId:1398] [186792] (2 PDB entries) |
Domain d1v5bb_: 1v5b B: [161829] automated match to d2ayqb_ complexed with so4; mutant |
PDB Entry: 1v5b (more details), 2.95 Å
SCOPe Domain Sequences for d1v5bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v5bb_ c.77.1.1 (B:) automated matches {Bacillus coagulans [TaxId: 1398]} mkmklavlpgdgigpevmdaairvlktvldndgheavfenaliggaaideagtplpeetl dicrrsdaillgavggpkwdhnpaslrpekgllglrkemglfanlrpvkayatllnaspl krervenvdlvivreltgglyfgrpserrgpgenevvdtlaytreeieriiekafqlaqi rrkklasvdkanvlessrmwreiaeetakkypdvelshmlvdstamqlianpgqfdvivt enmfgdilsdlasvitgslgmlpsaslrsdrfgmyepvhgsapdiagqgkanplgtvlsa almlrysfglekeaaaiekavddvlqdgyctgdlqvangkvvstieltdrlieklnn
Timeline for d1v5bb_: