Lineage for d1v5ba_ (1v5b A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2905793Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2905990Protein automated matches [190072] (22 species)
    not a true protein
  7. 2905999Species Bacillus coagulans [TaxId:1398] [186792] (2 PDB entries)
  8. 2906002Domain d1v5ba_: 1v5b A: [161828]
    automated match to d2ayqb_
    complexed with so4; mutant

Details for d1v5ba_

PDB Entry: 1v5b (more details), 2.95 Å

PDB Description: the structure of the mutant, s225a and e251l, of 3-isopropylmalate dehydrogenase from bacillus coagulans
PDB Compounds: (A:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d1v5ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5ba_ c.77.1.1 (A:) automated matches {Bacillus coagulans [TaxId: 1398]}
mkmklavlpgdgigpevmdaairvlktvldndgheavfenaliggaaideagtplpeetl
dicrrsdaillgavggpkwdhnpaslrpekgllglrkemglfanlrpvkayatllnaspl
krervenvdlvivreltgglyfgrpserrgpgenevvdtlaytreeieriiekafqlaqi
rrkklasvdkanvlessrmwreiaeetakkypdvelshmlvdstamqlianpgqfdvivt
enmfgdilsdlasvitgslgmlpsaslrsdrfgmyepvhgsapdiagqgkanplgtvlsa
almlrysfglekeaaaiekavddvlqdgyctgdlqvangkvvstieltdrliekln

SCOPe Domain Coordinates for d1v5ba_:

Click to download the PDB-style file with coordinates for d1v5ba_.
(The format of our PDB-style files is described here.)

Timeline for d1v5ba_: