Lineage for d1v0zc_ (1v0z C:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 959648Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 959649Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 959650Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 959827Protein automated matches [190279] (4 species)
    not a true protein
  7. 959843Species Influenza A virus [TaxId:11320] [187447] (5 PDB entries)
  8. 959846Domain d1v0zc_: 1v0z C: [161826]
    automated match to d5nn9a_
    complexed with ca, gol, man, nag, peg

Details for d1v0zc_

PDB Entry: 1v0z (more details), 1.84 Å

PDB Description: structure of neuraminidase from english duck subtype n6
PDB Compounds: (C:) Neuraminidase

SCOPe Domain Sequences for d1v0zc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v0zc_ b.68.1.1 (C:) automated matches {Influenza A virus [TaxId: 11320]}
rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
snsivalcgskkrlgswswhdgaeiiyfe

SCOPe Domain Coordinates for d1v0zc_:

Click to download the PDB-style file with coordinates for d1v0zc_.
(The format of our PDB-style files is described here.)

Timeline for d1v0zc_: