SCOPe 2.01: Domain d1v0zb_: 1v0z B:

Lineage for d1v0zb_ (1v0z B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.1: Sialidases [50939] (3 families)

5. Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)

6. Protein automated matches [190279] (4 species)
   not a true protein

7. Species Influenza A virus [TaxId:11320] [187447] (5 PDB entries)

8. Domain d1v0zb_: 1v0z B: [161825]
   automated match to d5nn9a_
   complexed with ca, gol, man, nag, peg

Details for d1v0zb_

PDB Entry: 1v0z, 1.84 Å

PDB Description: structure of neuraminidase from english duck subtype n6

PDB Compounds: (B:) Neuraminidase

SCOPe Domain Sequences for d1v0zb_:

Sequence; same for both SEQRES and ATOM records:

>d1v0zb_ b.68.1.1 (B:) automated matches {Influenza A virus [TaxId: 11320]}
rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
snsivalcgskkrlgswswhdgaeiiyfe

Timeline for d1v0zb_:

• d1v0zb_ is new in SCOPe 2.01-stable
  
• d1v0zb_ appears in SCOPe 2.02
  
• d1v0zb_ appears in the current release, SCOPe 2.08