Lineage for d1upmf_ (1upm F:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1208801Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1208802Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 1208803Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 1208804Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 1208881Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (10 PDB entries)
  8. 1208915Domain d1upmf_: 1upm F: [161813]
    automated match to d1aa1c_
    complexed with ca, cap

Details for d1upmf_

PDB Entry: 1upm (more details), 2.3 Å

PDB Description: activated spinach rubisco complexed with 2-carboxyarabinitol 2 bisphosphat and ca2+.
PDB Compounds: (F:) ribulose bisphosphate carboxylase small chain

SCOPe Domain Sequences for d1upmf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upmf_ d.73.1.1 (F:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

SCOPe Domain Coordinates for d1upmf_:

Click to download the PDB-style file with coordinates for d1upmf_.
(The format of our PDB-style files is described here.)

Timeline for d1upmf_: