Lineage for d1uosb_ (1uos B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001710Protein Snake coagglutinin beta chain [88867] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 3001743Species South american rattlesnake (Crotalus durissus terrificus), convulxin [TaxId:8732] [103348] (2 PDB entries)
  8. 3001746Domain d1uosb_: 1uos B: [161809]
    Other proteins in same PDB: d1uosa_, d1uosc_
    automated match to d1umrc_

Details for d1uosb_

PDB Entry: 1uos (more details), 2.7 Å

PDB Description: the crystal structure of the snake venom toxin convulxin
PDB Compounds: (B:) convulxin beta

SCOPe Domain Sequences for d1uosb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uosb_ d.169.1.1 (B:) Snake coagglutinin beta chain {South american rattlesnake (Crotalus durissus terrificus), convulxin [TaxId: 8732]}
fccpshwssydrycykvfkqemtwadaekfctqqhtgshlvsfhsteevdfvvkmthqsl
kstffwiganniwnkcnwqwsdgtkpeykewheefeclisrtfdnqwlsapcsdtysfvc
kfea

SCOPe Domain Coordinates for d1uosb_:

Click to download the PDB-style file with coordinates for d1uosb_.
(The format of our PDB-style files is described here.)

Timeline for d1uosb_: