Lineage for d1uosa_ (1uos A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1048063Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1048064Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1048065Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1048333Protein Snake coagglutinin alpha chain [88861] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 1048366Species South american rattlesnake (Crotalus durissus terrificus), convulxin [TaxId:8732] [103344] (2 PDB entries)
  8. 1048369Domain d1uosa_: 1uos A: [161808]
    Other proteins in same PDB: d1uosb_, d1uosd_
    automated match to d1umra_

Details for d1uosa_

PDB Entry: 1uos (more details), 2.7 Å

PDB Description: the crystal structure of the snake venom toxin convulxin
PDB Compounds: (A:) convulxin alpha

SCOPe Domain Sequences for d1uosa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uosa_ d.169.1.1 (A:) Snake coagglutinin alpha chain {South american rattlesnake (Crotalus durissus terrificus), convulxin [TaxId: 8732]}
hcpsdwyyydqhcyrifneemnwedaewfctkqakgahlvsiksakeadfvawmvtqnie
esfshvsiglrvqnkekqcstkwsdgssvsydnlldlyitkcsllkketgfrkwfvasci
gkipfvckfppqc

SCOPe Domain Coordinates for d1uosa_:

Click to download the PDB-style file with coordinates for d1uosa_.
(The format of our PDB-style files is described here.)

Timeline for d1uosa_: