SCOPe 2.01: Domain d1u71a_: 1u71 A:

Lineage for d1u71a_ (1u71 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductases, eukaryotic type [53605] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53607] (50 PDB entries)

8. Domain d1u71a_: 1u71 A: [161805]
   automated match to d1dlra_
   complexed with mxa, so4

Details for d1u71a_

PDB Entry: 1u71, 2.2 Å

PDB Description: understanding the role of leu22 variants in methotrexate resistance: comparison of wild-type and leu22arg variant mouse and human dihydrofolate reductase ternary crystal complexes with methotrexate and nadph

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1u71a_:

Sequence; same for both SEQRES and ATOM records:

>d1u71a_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Human (Homo sapiens) [TaxId: 9606]}
vgslncivavsqnmgigkngdrpwpplrnefryfqrmtttssvegkqnlvimgkktwfsi
peknrplkgrinlvlsrelkeppqgahflsrslddalklteqpelankvdmvwivggssv
ykeamnhpghlklfvtrimqdfesdtffpeidlekykllpeypgvlsdvqeekgikykfe
vyeknd

Timeline for d1u71a_:

• d1u71a_ is new in SCOPe 2.01-stable
  
• d1u71a_ appears in SCOPe 2.02
  
• d1u71a_ appears in the current release, SCOPe 2.08