Lineage for d1u70a_ (1u70 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2510890Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2511215Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 2511360Species Mouse (Mus musculus) [TaxId:10090] [187727] (6 PDB entries)
  8. 2511366Domain d1u70a_: 1u70 A: [161804]
    automated match to d1dlsa_
    complexed with mtx, ndp

Details for d1u70a_

PDB Entry: 1u70 (more details), 2.5 Å

PDB Description: understanding the role of leu22 variants in methotrexate resistance: comparison of wild-type and leu22arg variant mouse and human dihydrofolate reductase
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1u70a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u70a_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Mouse (Mus musculus) [TaxId: 10090]}
vrplncivavsqnmgigkngdrpwpplrnefkyfqrmtttssvegkqnlvimgrktwfsi
peknrplkdrinivlsrelkepprgahflakslddalrlieqpelaskvdmvwivggssv
yqeamnqpghlrlfvtrimqefesdtffpeidlgkykllpeypgvlsevqeekgikykfe
vyekkd

SCOPe Domain Coordinates for d1u70a_:

Click to download the PDB-style file with coordinates for d1u70a_.
(The format of our PDB-style files is described here.)

Timeline for d1u70a_: