SCOPe 2.04: Domain d1u4ea_: 1u4e A:

Lineage for d1u4ea_ (1u4e A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins)

6. Protein automated matches [190782] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188028] (9 PDB entries)

8. Domain d1u4ea_: 1u4e A: [161803]
   automated match to d1n9pa_

Details for d1u4ea_

PDB Entry: 1u4e, 2.09 Å

PDB Description: crystal structure of cytoplasmic domains of girk1 channel

PDB Compounds: (A:) G protein-activated inward rectifier potassium channel 1

SCOPe Domain Sequences for d1u4ea_:

Sequence, based on SEQRES records:

>d1u4ea_ b.1.18.16 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krqrfvdkngrcnvqhgnlgsekraetlmfsehavismrdgkltlmfrvgnlrnshmvsa
qirckllksrqtpegeflpldqleldvgfstgadqlflvspltichvidakspfydlsqr
smqteqfevvvilegivettgmtcqartsytedevlwghrffpvisleegffkvdysqfh
atfevptppysvkeqeemllmssp

Sequence, based on observed residues (ATOM records):

>d1u4ea_ b.1.18.16 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krqrfvdkngrcnvqhgnlraetlmfsehavismrdgkltlmfrvgnlrnshmvsaqirc
kllksrqtpegeflpldqleldvgfstgadqlflvspltichvidakspfydlsqrsmqt
eqfevvvilegivettgmtcqartsytedevlwghrffpvisleegffkvdysqfhatfe
vptppysvkeqeemllmssp

Timeline for d1u4ea_:

• d1u4ea_ first appeared in SCOPe 2.01
  
• d1u4ea_ appears in SCOPe 2.03
  
• d1u4ea_ appears in SCOPe 2.05
  
• d1u4ea_ appears in the current release, SCOPe 2.08