Lineage for d1fbsa1 (1fbs A:195-281)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306933Family a.4.5.22: Heat-shock transcription factor [46873] (2 proteins)
    automatically mapped to Pfam PF00447
  6. 2306934Protein Heat-shock transcription factor [46874] (2 species)
  7. 2306938Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [46876] (9 PDB entries)
  8. 2306943Domain d1fbsa1: 1fbs A:195-281 [16180]
    Other proteins in same PDB: d1fbsa2, d1fbsb2
    mutant

Details for d1fbsa1

PDB Entry: 1fbs (more details), 2 Å

PDB Description: heat shock transcription factor dna binding domain containing the p237a mutation
PDB Compounds: (A:) heat shock factor protein

SCOPe Domain Sequences for d1fbsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbsa1 a.4.5.22 (A:195-281) Heat-shock transcription factor {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
pafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlakyfkhsnfasfvrqlnm
ygwhkvqdvksgsmlsnndsrwefene

SCOPe Domain Coordinates for d1fbsa1:

Click to download the PDB-style file with coordinates for d1fbsa1.
(The format of our PDB-style files is described here.)

Timeline for d1fbsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fbsa2