Lineage for d1fbsa_ (1fbs A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1432Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families) (S)
  5. 1609Family a.4.5.22: Heat-shock transcription factor [46873] (1 protein)
  6. 1610Protein Heat-shock transcription factor [46874] (2 species)
  7. 1614Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [46876] (6 PDB entries)
  8. 1621Domain d1fbsa_: 1fbs A: [16180]

Details for d1fbsa_

PDB Entry: 1fbs (more details), 2 Å

PDB Description: heat shock transcription factor dna binding domain containing the p237a mutation

SCOP Domain Sequences for d1fbsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbsa_ a.4.5.22 (A:) Heat-shock transcription factor {Milk yeast (Kluyveromyces lactis)}
pafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlakyfkhsnfasfvrqlnm
ygwhkvqdvksgsmlsnndsrwefener

SCOP Domain Coordinates for d1fbsa_:

Click to download the PDB-style file with coordinates for d1fbsa_.
(The format of our PDB-style files is described here.)

Timeline for d1fbsa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fbsb_