SCOPe 2.08: Domain d1fbsa1: 1fbs A:195-281

Lineage for d1fbsa1 (1fbs A:195-281)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.22: Heat-shock transcription factor [46873] (2 proteins)
   automatically mapped to Pfam PF00447

6. Protein Heat-shock transcription factor [46874] (2 species)

7. Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [46876] (9 PDB entries)

8. Domain d1fbsa1: 1fbs A:195-281 [16180]
   Other proteins in same PDB: d1fbsa2, d1fbsb2
   mutant

Details for d1fbsa1

PDB Entry: 1fbs, 2 Å

PDB Description: heat shock transcription factor dna binding domain containing the p237a mutation

PDB Compounds: (A:) heat shock factor protein

SCOPe Domain Sequences for d1fbsa1:

Sequence; same for both SEQRES and ATOM records:

>d1fbsa1 a.4.5.22 (A:195-281) Heat-shock transcription factor {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
pafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlakyfkhsnfasfvrqlnm
ygwhkvqdvksgsmlsnndsrwefene

Timeline for d1fbsa1:

• d1fbsa1 first appeared (with stable ids) in SCOP 1.55, called d1fbsa_
  
• d1fbsa1 appears in SCOPe 2.07