SCOPe 2.07: Domain d1u2ea_: 1u2e A:

Lineage for d1u2ea_ (1u2e A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (103 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [188027] (1 PDB entry)

8. Domain d1u2ea_: 1u2e A: [161798]
   automated match to d2puha1
   complexed with cl

Details for d1u2ea_

PDB Entry: 1u2e, 2.1 Å

PDB Description: Crystal Structure of the C-C bond hydrolase MhpC

PDB Compounds: (A:) 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase

SCOPe Domain Sequences for d1u2ea_:

Sequence; same for both SEQRES and ATOM records:

>d1u2ea_ c.69.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
yqpqteaatsrflnveeagktlrihfndcgqgdetvvllhgsgpgatgwanfsrnidplv
eagyrvilldcpgwgksdsvvnsgsrsdlnarilksvvdqldiakihllgnsmgghssva
ftlkwpervgklvlmgggtggmslftpmptegikrlnqlyrqptienlklmmdifvfdts
dltdalfearlnnmlsrrdhlenfvksleanpkqfpdfgprlaeikaqtlivwgrndrfv
pmdaglrllsgiagselhifrdcghwaqwehadafnqlvlnflarp

Timeline for d1u2ea_:

• d1u2ea_ first appeared in SCOPe 2.01
  
• d1u2ea_ appears in SCOPe 2.06