Lineage for d1u0ab_ (1u0a B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779081Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 2779082Protein Bacillus 1-3,1-4-beta-glucanase [49926] (5 species)
  7. 2779103Species Paenibacillus macerans [TaxId:44252] [188026] (1 PDB entry)
  8. 2779105Domain d1u0ab_: 1u0a B: [161793]
    automated match to d1byha_
    complexed with ca, zn

Details for d1u0ab_

PDB Entry: 1u0a (more details), 1.64 Å

PDB Description: crystal structure of the engineered beta-1,3-1,4-endoglucanase h(a16- m) in complex with beta-glucan tetrasaccharide
PDB Compounds: (B:) Beta-glucanase

SCOPe Domain Sequences for d1u0ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0ab_ b.29.1.2 (B:) Bacillus 1-3,1-4-beta-glucanase {Paenibacillus macerans [TaxId: 44252]}
qtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfd
caeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdqidiqflgkdttkvqf
nyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkim
mnlwngtgvddwlgsynganplyaeydwvkytsn

SCOPe Domain Coordinates for d1u0ab_:

Click to download the PDB-style file with coordinates for d1u0ab_.
(The format of our PDB-style files is described here.)

Timeline for d1u0ab_: