SCOP 1.55: Domain d1fbqb_: 1fbq B:

Lineage for d1fbqb_ (1fbq B:)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families)

5. Family a.4.5.22: Heat-shock transcription factor [46873] (1 protein)

6. Protein Heat-shock transcription factor [46874] (2 species)

7. Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [46876] (6 PDB entries)

8. Domain d1fbqb_: 1fbq B: [16179]

Details for d1fbqb_

PDB Entry: 1fbq, 2 Å

PDB Description: heat shock transcription factor dna binding domain containing the p237k mutation

SCOP Domain Sequences for d1fbqb_:

Sequence; same for both SEQRES and ATOM records:

>d1fbqb_ a.4.5.22 (B:) Heat-shock transcription factor {Milk yeast (Kluyveromyces lactis)}
pafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlkkyfkhsnfasfvrqlnm
ygwhkvqdvksgsmlsnndsrwefenerha

Timeline for d1fbqb_:

• d1fbqb_ appears in SCOP 1.57
  
• d1fbqb_ appears in the current release, SCOPe 2.08, called d1fbqb1