SCOPe 2.02: Domain d1tyoa_: 1tyo A:

Lineage for d1tyoa_ (1tyo A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.0: automated matches [191423] (1 protein)
   not a true family

6. Protein automated matches [190603] (14 species)
   not a true protein

7. Species Aeropyrum pernix [TaxId:56636] [188025] (3 PDB entries)

8. Domain d1tyoa_: 1tyo A: [161789]
   automated match to d1hqsa_
   complexed with enp

Details for d1tyoa_

PDB Entry: 1tyo, 2.15 Å

PDB Description: isocitrate dehydrogenase from the hyperthermophile aeropyrum pernix in complex with etheno-nadp

PDB Compounds: (A:) isocitrate dehydrogenase

SCOPe Domain Sequences for d1tyoa_:

Sequence; same for both SEQRES and ATOM records:

>d1tyoa_ c.77.1.0 (A:) automated matches {Aeropyrum pernix [TaxId: 56636]}
sppctteelspppggslveysggslrvpdnpvvafirgdgvgpevvesalkvvdaavkkv
yggsrrivwwellaghlarekcgellpkatlegirlarvalkgpletpvgtgyrslnvai
rqaldlyanirpvryygqpaphkyadrvdmvifrentedvyagiewphdspeaarirrfl
aeefgisiredagigvkpisrfatrrlmeralewalrngntvvtimhkgnimkytegafm
rwayevalekfrehvvteqevqekyggvrpegkilvndriadnmlqqiitrpwdyqviva
pnlngdyisdaasalvggigmaagmnmgdgiavaepvhgtapkyagkdlinpsaeilsas
lligefmgwrevksiveyairkavqskkvtqdlarhmpgvqplrtseytetliayidead
lnevlag

Timeline for d1tyoa_:

• d1tyoa_ first appeared in SCOPe 2.01
  
• d1tyoa_ appears in SCOPe 2.03
  
• d1tyoa_ appears in the current release, SCOPe 2.08