Lineage for d1ttob_ (1tto B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2494618Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2494619Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2494861Family d.1.1.4: Fungal ribonucleases [81311] (4 protein domains)
  6. 2494872Protein RNase T1 [53939] (2 species)
  7. 2494875Species Fungus (Aspergillus oryzae) [TaxId:5062] [53940] (67 PDB entries)
  8. 2494936Domain d1ttob_: 1tto B: [161784]
    automated match to d1q9ea_
    complexed with trs

Details for d1ttob_

PDB Entry: 1tto (more details), 2.1 Å

PDB Description: Crystal structure of the Rnase T1 variant R2
PDB Compounds: (B:) RNase T1

SCOPe Domain Sequences for d1ttob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ttob_ d.1.1.4 (B:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphefrnwngfdfsvsspyyeyp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

SCOPe Domain Coordinates for d1ttob_:

Click to download the PDB-style file with coordinates for d1ttob_.
(The format of our PDB-style files is described here.)

Timeline for d1ttob_: