![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
![]() | Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) ![]() |
![]() | Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins) |
![]() | Protein RNase T1 [53939] (2 species) |
![]() | Species Fungus (Aspergillus oryzae) [TaxId:5062] [53940] (67 PDB entries) |
![]() | Domain d1ttob_: 1tto B: [161784] automated match to d1q9ea_ complexed with trs |
PDB Entry: 1tto (more details), 2.1 Å
SCOPe Domain Sequences for d1ttob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ttob_ d.1.1.4 (B:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]} acdytcgsncysssdvstaqaagyklhedgetvgsnsyphefrnwngfdfsvsspyyeyp ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect
Timeline for d1ttob_: