Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.22: Heat-shock transcription factor [46873] (2 proteins) automatically mapped to Pfam PF00447 |
Protein Heat-shock transcription factor [46874] (2 species) |
Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [46876] (9 PDB entries) |
Domain d1fbqa1: 1fbq A:195-281 [16178] Other proteins in same PDB: d1fbqa2, d1fbqb2 mutant |
PDB Entry: 1fbq (more details), 2 Å
SCOPe Domain Sequences for d1fbqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fbqa1 a.4.5.22 (A:195-281) Heat-shock transcription factor {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]} pafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlkkyfkhsnfasfvrqlnm ygwhkvqdvksgsmlsnndsrwefene
Timeline for d1fbqa1: