Lineage for d1tg9a_ (1tg9 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2420906Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2420907Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2420908Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2420909Protein Carbonic anhydrase [51071] (10 species)
  7. 2420951Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (971 PDB entries)
    Uniprot P00918
  8. 2421836Domain d1tg9a_: 1tg9 A: [161772]
    automated match to d1cana_
    complexed with zn

Details for d1tg9a_

PDB Entry: 1tg9 (more details), 1.9 Å

PDB Description: effect of shuttle location and ph environment on h+ transfer in human carbonic anhydrase ii
PDB Compounds: (A:) carbonic anhydrase II

SCOPe Domain Sequences for d1tg9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tg9a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnh
ghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

SCOPe Domain Coordinates for d1tg9a_:

Click to download the PDB-style file with coordinates for d1tg9a_.
(The format of our PDB-style files is described here.)

Timeline for d1tg9a_: