Lineage for d1tfja_ (1tfj A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737813Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily)
    multihelical; 2 layers or orthogonally packed helices
  4. 2737814Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family) (S)
  5. 2737815Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (2 proteins)
  6. 2737816Protein Glycolipid transfer protein, GLTP [110006] (2 species)
  7. 2737817Species Cow (Bos taurus) [TaxId:9913] [188023] (1 PDB entry)
  8. 2737818Domain d1tfja_: 1tfj A: [161770]
    automated match to d1swxa_
    complexed with cl, dka, gol

Details for d1tfja_

PDB Entry: 1tfj (more details), 1.61 Å

PDB Description: crystal structure of bovine glycolipid transfer protein in complex with a fatty acid
PDB Compounds: (A:) glycolipid transfer protein

SCOPe Domain Sequences for d1tfja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfja_ a.224.1.1 (A:) Glycolipid transfer protein, GLTP {Cow (Bos taurus) [TaxId: 9913]}
ehllrplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtnpt
kfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlir
vnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekvrlflv
nytatidviyemytrmnaelnykv

SCOPe Domain Coordinates for d1tfja_:

Click to download the PDB-style file with coordinates for d1tfja_.
(The format of our PDB-style files is described here.)

Timeline for d1tfja_: