![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
![]() | Protein Plastocyanin [49507] (17 species) |
![]() | Species Spinach (Spinacia oleracea) [TaxId:3562] [49511] (4 PDB entries) |
![]() | Domain d1tegb_: 1teg B: [161769] automated match to d1ag6a_ complexed with cl, cu; mutant |
PDB Entry: 1teg (more details), 1.96 Å
SCOPe Domain Sequences for d1tegb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tegb_ b.6.1.1 (B:) Plastocyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} vevllgggdgslaflpgdfsvasgeeivfcnnagfphnvvfdedeipsgvdaakismsee dllnapgecykvtltekgtykfycsphqgagmvgkvtvn
Timeline for d1tegb_: