Lineage for d1tega_ (1teg A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2366404Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 protein domains)
    mono-domain proteins
  6. 2366813Protein Plastocyanin [49507] (16 species)
  7. 2366879Species Spinach (Spinacia oleracea) [TaxId:3562] [49511] (4 PDB entries)
  8. 2366882Domain d1tega_: 1teg A: [161768]
    automated match to d1ag6a_
    complexed with cl, cu; mutant

Details for d1tega_

PDB Entry: 1teg (more details), 1.96 Å

PDB Description: crystal structure of the spinach plastocyanin mutants g8d/k30c/t69c and k30c/t69c- a study of the effect on crystal packing and thermostability from the introduction of a novel disulfide bond
PDB Compounds: (A:) Plastocyanin, chloroplast

SCOPe Domain Sequences for d1tega_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tega_ b.6.1.1 (A:) Plastocyanin {Spinach (Spinacia oleracea) [TaxId: 3562]}
vevllgggdgslaflpgdfsvasgeeivfcnnagfphnvvfdedeipsgvdaakismsee
dllnapgecykvtltekgtykfycsphqgagmvgkvtvn

SCOPe Domain Coordinates for d1tega_:

Click to download the PDB-style file with coordinates for d1tega_.
(The format of our PDB-style files is described here.)

Timeline for d1tega_: