SCOPe 2.08: Domain d1tefb_: 1tef B:

Lineage for d1tefb_ (1tef B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (17 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [49511] (4 PDB entries)

8. Domain d1tefb_: 1tef B: [161767]
   automated match to d1ag6a_
   complexed with cl, cu; mutant

Details for d1tefb_

PDB Entry: 1tef, 1.9 Å

PDB Description: crystal structure of the spinach plastocyanin mutants g8d/k30c/t69c and k30c/t69c- a study of the effect on crystal packing and thermostability from the introduction of a novel disulfide bond

PDB Compounds: (B:) Plastocyanin, chloroplast

SCOPe Domain Sequences for d1tefb_:

Sequence; same for both SEQRES and ATOM records:

>d1tefb_ b.6.1.1 (B:) Plastocyanin {Spinach (Spinacia oleracea) [TaxId: 3562]}
vevllggddgslaflpgdfsvasgeeivfcnnagfphnvvfdedeipsgvdaakismsee
dllnapgecykvtltekgtykfycsphqgagmvgkvtvn

Timeline for d1tefb_:

• d1tefb_ first appeared in SCOPe 2.01
  
• d1tefb_ appears in SCOPe 2.07