Lineage for d1tcua_ (1tcu A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2495644Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2496659Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2496660Protein automated matches [190781] (45 species)
    not a true protein
  7. 2496691Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [188022] (46 PDB entries)
  8. 2496720Domain d1tcua_: 1tcu A: [161757]
    automated match to d1a9oa_
    complexed with act, dms, po4

Details for d1tcua_

PDB Entry: 1tcu (more details), 2 Å

PDB Description: Crystal Structure of the Purine Nucleoside Phosphorylase from Schistosoma mansoni in complex with phosphate and acetate
PDB Compounds: (A:) purine-nucleoside phosphorylase

SCOPe Domain Sequences for d1tcua_:

Sequence, based on SEQRES records: (download)

>d1tcua_ c.56.2.0 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
esvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpqts
vvghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaaggl
nrslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqvaee
ngfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfavsl
vtnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd

Sequence, based on observed residues (ATOM records): (download)

>d1tcua_ c.56.2.0 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
esvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpqts
hsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaagglnrs
lklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqvaeengf
gnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfavslvtn
isvldvesdlkpnheevlatgaqraelmqswfekiieklpkd

SCOPe Domain Coordinates for d1tcua_:

Click to download the PDB-style file with coordinates for d1tcua_.
(The format of our PDB-style files is described here.)

Timeline for d1tcua_: