Lineage for d1t93a1 (1t93 A:4-404)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005512Species Streptomyces coelicolor [TaxId:100226] [187338] (8 PDB entries)
  8. 2005513Domain d1t93a1: 1t93 A:4-404 [161752]
    Other proteins in same PDB: d1t93a2
    automated match to d1s1fa_
    complexed with flv, hem

Details for d1t93a1

PDB Entry: 1t93 (more details), 1.62 Å

PDB Description: Evidence for Multiple Substrate Recognition and Molecular Mechanism of C-C reaction by Cytochrome P450 CYP158A2 from Streptomyces Coelicolor A3(2)
PDB Compounds: (A:) putative cytochrome P450

SCOPe Domain Sequences for d1t93a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t93a1 a.104.1.1 (A:4-404) automated matches {Streptomyces coelicolor [TaxId: 100226]}
etisqavppvrdwpavdlpgsdfdpvltelmregpvtrislpngegwawlvtrhddvrlv
tndprfgreavmdrqvtrlaphfipargavgfldppdhtrlrrsvaaaftargvervrer
srgmldelvdamlragppadlteavlspfpiavicelmgvpatdrhsmhtwtqlilsssh
gaevseraknemnayfsdliglrsdsagedvtsllgaavgrdeitlseavglavllqigg
eavtnnsgqmfhlllsrpelaerlrsepeirpraidellrwiphrnavglsrialedvei
kgvriragdavyvsylaanrdpevfpdpdridferspnphvsfgfgphycpggmlarles
ellvdavldrvpglklavapedvpfkkgalirgpealpvtw

SCOPe Domain Coordinates for d1t93a1:

Click to download the PDB-style file with coordinates for d1t93a1.
(The format of our PDB-style files is described here.)

Timeline for d1t93a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t93a2