Lineage for d3htsb_ (3hts B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693501Family a.4.5.22: Heat-shock transcription factor [46873] (2 proteins)
    automatically mapped to Pfam PF00447
  6. 2693502Protein Heat-shock transcription factor [46874] (2 species)
  7. 2693506Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [46876] (9 PDB entries)
  8. 2693508Domain d3htsb_: 3hts B: [16175]
    protein/DNA complex; complexed with gol

Details for d3htsb_

PDB Entry: 3hts (more details), 1.75 Å

PDB Description: heat shock transcription factor/dna complex
PDB Compounds: (B:) heat shock transcription factor

SCOPe Domain Sequences for d3htsb_:

Sequence, based on SEQRES records: (download)

>d3htsb_ a.4.5.22 (B:) Heat-shock transcription factor {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
marpafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrq
lnmygwhkvqdvksgsmlsnndsrwefener

Sequence, based on observed residues (ATOM records): (download)

>d3htsb_ a.4.5.22 (B:) Heat-shock transcription factor {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
marpafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrq
lnmygwhkvqnndsrwefener

SCOPe Domain Coordinates for d3htsb_:

Click to download the PDB-style file with coordinates for d3htsb_.
(The format of our PDB-style files is described here.)

Timeline for d3htsb_: