Lineage for d1t6mb_ (1t6m B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2101609Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 2101638Family c.1.18.2: Bacterial PLC [51699] (2 proteins)
  6. 2101653Protein automated matches [190760] (1 species)
    not a true protein
  7. 2101654Species Bacillus thuringiensis [TaxId:1428] [187965] (5 PDB entries)
  8. 2101664Domain d1t6mb_: 1t6m B: [161749]
    automated match to d1gyma_
    complexed with ca

Details for d1t6mb_

PDB Entry: 1t6m (more details), 2.11 Å

PDB Description: x-ray structure of the r70d pi-plc enzyme: insight into the role of calcium and surrounding amino acids on active site geometry and catalysis.
PDB Compounds: (B:) 1-phosphatidylinositol phosphodiesterase

SCOPe Domain Sequences for d1t6mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t6mb_ c.1.18.2 (B:) automated matches {Bacillus thuringiensis [TaxId: 1428]}
assvnelenwskwmqpipdniplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
hgarifdidgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
mkgaegsfsstfeknyfvdpiflktegniklgdargkivllkrysgsnesggynnfywpd
netftttvnqnvnvtvqdkykvnydekvksikdtmdetmnnsedlnhlyinftslssggt
awnspyyyasyinpeiandikqknptrvgwviqdyinekwspllyqeviranksli

SCOPe Domain Coordinates for d1t6mb_:

Click to download the PDB-style file with coordinates for d1t6mb_.
(The format of our PDB-style files is described here.)

Timeline for d1t6mb_: