SCOPe 2.05: Domain d1t6mb_: 1t6m B:

Lineage for d1t6mb_ (1t6m B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families)

5. Family c.1.18.2: Bacterial PLC [51699] (2 proteins)

6. Protein automated matches [190760] (1 species)
   not a true protein

7. Species Bacillus thuringiensis [TaxId:1428] [187965] (5 PDB entries)

8. Domain d1t6mb_: 1t6m B: [161749]
   automated match to d1gyma_
   complexed with ca

Details for d1t6mb_

PDB Entry: 1t6m, 2.11 Å

PDB Description: x-ray structure of the r70d pi-plc enzyme: insight into the role of calcium and surrounding amino acids on active site geometry and catalysis.

PDB Compounds: (B:) 1-phosphatidylinositol phosphodiesterase

SCOPe Domain Sequences for d1t6mb_:

Sequence; same for both SEQRES and ATOM records:

>d1t6mb_ c.1.18.2 (B:) automated matches {Bacillus thuringiensis [TaxId: 1428]}
assvnelenwskwmqpipdniplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
hgarifdidgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
mkgaegsfsstfeknyfvdpiflktegniklgdargkivllkrysgsnesggynnfywpd
netftttvnqnvnvtvqdkykvnydekvksikdtmdetmnnsedlnhlyinftslssggt
awnspyyyasyinpeiandikqknptrvgwviqdyinekwspllyqeviranksli

Timeline for d1t6mb_:

• d1t6mb_ first appeared in SCOPe 2.01
  
• d1t6mb_ appears in SCOPe 2.04
  
• d1t6mb_ appears in SCOPe 2.06
  
• d1t6mb_ appears in the current release, SCOPe 2.08