Lineage for d1t6ma_ (1t6m A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1825748Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 1825776Family c.1.18.2: Bacterial PLC [51699] (2 proteins)
  6. 1825791Protein automated matches [190760] (1 species)
    not a true protein
  7. 1825792Species Bacillus thuringiensis [TaxId:1428] [187965] (5 PDB entries)
  8. 1825801Domain d1t6ma_: 1t6m A: [161748]
    automated match to d1gyma_
    complexed with ca

Details for d1t6ma_

PDB Entry: 1t6m (more details), 2.11 Å

PDB Description: x-ray structure of the r70d pi-plc enzyme: insight into the role of calcium and surrounding amino acids on active site geometry and catalysis.
PDB Compounds: (A:) 1-phosphatidylinositol phosphodiesterase

SCOPe Domain Sequences for d1t6ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t6ma_ c.1.18.2 (A:) automated matches {Bacillus thuringiensis [TaxId: 1428]}
assvnelenwskwmqpipdniplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
hgarifdidgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
mkgaegsfsstfeknyfvdpiflktegniklgdargkivllkrysgsnesggynnfywpd
netftttvnqnvnvtvqdkykvnydekvksikdtmdetmnnsedlnhlyinftslssggt
awnspyyyasyinpeiandikqknptrvgwviqdyinekwspllyqeviranksli

SCOPe Domain Coordinates for d1t6ma_:

Click to download the PDB-style file with coordinates for d1t6ma_.
(The format of our PDB-style files is described here.)

Timeline for d1t6ma_: