![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) ![]() |
![]() | Family c.1.18.2: Bacterial PLC [51699] (2 proteins) |
![]() | Protein automated matches [190760] (2 species) not a true protein |
![]() | Species Bacillus thuringiensis [TaxId:1428] [187965] (5 PDB entries) |
![]() | Domain d1t6ma_: 1t6m A: [161748] automated match to d1gyma_ complexed with ca |
PDB Entry: 1t6m (more details), 2.11 Å
SCOPe Domain Sequences for d1t6ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t6ma_ c.1.18.2 (A:) automated matches {Bacillus thuringiensis [TaxId: 1428]} assvnelenwskwmqpipdniplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd hgarifdidgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed mkgaegsfsstfeknyfvdpiflktegniklgdargkivllkrysgsnesggynnfywpd netftttvnqnvnvtvqdkykvnydekvksikdtmdetmnnsedlnhlyinftslssggt awnspyyyasyinpeiandikqknptrvgwviqdyinekwspllyqeviranksli
Timeline for d1t6ma_: