Lineage for d1t5cb_ (1t5c B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114207Species Human (Homo sapiens) [TaxId:9606] [186862] (124 PDB entries)
  8. 2114343Domain d1t5cb_: 1t5c B: [161747]
    automated match to d1goja_
    complexed with adp, mg, no3, pin

Details for d1t5cb_

PDB Entry: 1t5c (more details), 2.5 Å

PDB Description: Crystal structure of the motor domain of human kinetochore protein CENP-E
PDB Compounds: (B:) Centromeric protein E

SCOPe Domain Sequences for d1t5cb_:

Sequence, based on SEQRES records: (download)

>d1t5cb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gavavcvrvrplnsreeslgetaqvywktdnnviyqvdgsksfnfdrvfhgnettknvye
eiaapiidsaiqgyngtifaygqtasgktytmmgsedhlgvipraihdifqkikkfpdre
fllrvsymeiynetitdllcgtqkmkpliiredvnrnvyvadlteevvytsemalkwitk
geksrhygetkmnqrssrshtifrmilesrekgepsncegsvkvshlnlvdlagseraaq
tgaagvrlkegcninrslfilgqvikklsdgqvggfinyrdskltrilqnslggnaktri
ictitpvsfdetltalqfastakymkntpyvnevs

Sequence, based on observed residues (ATOM records): (download)

>d1t5cb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gavavcvrvrplnaqvywktdnnviyqvdgsksfnfdrvfhgnettknvyeeiaapiids
aiqgyngtifaygqtasgktytmmgsedhlgvipraihdifqkikkfpdrefllrvsyme
iynetitdllcgtqkmkpliiredvnrnvyvadlteevvytsemalkwitkgeksrhyge
tkmnqrssrshtifrmilesreksvkvshlnlvdlagseraalkegcninrslfilgqvi
kklsdgqvggfinyrdskltrilqnslggnaktriictitpvsfdetltalqfastakym
kntpyvnevs

SCOPe Domain Coordinates for d1t5cb_:

Click to download the PDB-style file with coordinates for d1t5cb_.
(The format of our PDB-style files is described here.)

Timeline for d1t5cb_: