Lineage for d1t2ja1 (1t2j A:2-113)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (24 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) 
Domain d1t2ja1: 1t2j A:2-113 [161745]
Other proteins in same PDB: d1t2ja2
automated match to d1vhpa_
complexed with peg
Details for d1t2ja1
PDB Entry: 1t2j (more details), 1.5 Å
PDB Description: Crystal structure of a Human VH domain
PDB Compounds: (A:) M12-Variable Heavy domainSCOPe Domain Sequences for d1t2ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t2ja1 b.1.1.1 (A:2-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlqesggglvqpggslrlscaasgftfsnsamswvrqapgkglewvssisgsggntysa
dsvkgrftisrdnaknslylqmnslraedtavyycardwygmdvwgqgttvtvss
SCOPe Domain Coordinates for d1t2ja1:
Click to download the PDB-style file with coordinates for d1t2ja1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1t2ja1:
- d1t2ja1 first appeared in SCOPe 2.01, called d1t2ja_
- d1t2ja1 appears in SCOPe 2.07
View in 3D
