Lineage for d1t2ja1 (1t2j A:2-113)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (19 species)
    not a true protein
  7. 2347244Species Human (Homo sapiens) [TaxId:9606] [188740] (185 PDB entries)
  8. 2347245Domain d1t2ja1: 1t2j A:2-113 [161745]
    Other proteins in same PDB: d1t2ja2
    automated match to d1vhpa_
    complexed with peg

Details for d1t2ja1

PDB Entry: 1t2j (more details), 1.5 Å

PDB Description: Crystal structure of a Human VH domain
PDB Compounds: (A:) M12-Variable Heavy domain

SCOPe Domain Sequences for d1t2ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2ja1 b.1.1.1 (A:2-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlqesggglvqpggslrlscaasgftfsnsamswvrqapgkglewvssisgsggntysa
dsvkgrftisrdnaknslylqmnslraedtavyycardwygmdvwgqgttvtvss

SCOPe Domain Coordinates for d1t2ja1:

Click to download the PDB-style file with coordinates for d1t2ja1.
(The format of our PDB-style files is described here.)

Timeline for d1t2ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t2ja2