Lineage for d1t13e_ (1t13 E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2854558Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2854559Superfamily c.16.1: Lumazine synthase [52121] (2 families) (S)
  5. 2854560Family c.16.1.1: Lumazine synthase [52122] (2 proteins)
  6. 2854719Protein automated matches [190461] (5 species)
    not a true protein
  7. 2854720Species Brucella abortus [TaxId:235] [188021] (1 PDB entry)
  8. 2854725Domain d1t13e_: 1t13 E: [161744]
    automated match to d1di0a_
    complexed with ini, po4

Details for d1t13e_

PDB Entry: 1t13 (more details), 2.9 Å

PDB Description: crystal structure of lumazine synthase from brucella abortus bound to 5-nitro-6-(d-ribitylamino)-2,4(1h,3h) pyrimidinedione
PDB Compounds: (E:) 6,7-dimethyl-8-ribityllumazine synthase

SCOPe Domain Sequences for d1t13e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t13e_ c.16.1.1 (E:) automated matches {Brucella abortus [TaxId: 235]}
tsfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplhaktlartg
ryaaivgaafvidggiyrhdfvatavingmmqvqletevpvlsvvltphhfheskehhdf
fhahfkvkgveaahaalqivsersriaa

SCOPe Domain Coordinates for d1t13e_:

Click to download the PDB-style file with coordinates for d1t13e_.
(The format of our PDB-style files is described here.)

Timeline for d1t13e_: