Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.16.1: Lumazine synthase [52121] (2 families) |
Family c.16.1.1: Lumazine synthase [52122] (2 proteins) |
Protein automated matches [190461] (5 species) not a true protein |
Species Brucella abortus [TaxId:235] [188021] (1 PDB entry) |
Domain d1t13b_: 1t13 B: [161741] automated match to d1di0a_ complexed with ini, po4 |
PDB Entry: 1t13 (more details), 2.9 Å
SCOPe Domain Sequences for d1t13b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t13b_ c.16.1.1 (B:) automated matches {Brucella abortus [TaxId: 235]} sfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplhaktlartgr yaaivgaafvidggiyrhdfvatavingmmqvqletevpvlsvvltphhfheskehhdff hahfkvkgveaahaalqivsersriaa
Timeline for d1t13b_:
View in 3D Domains from other chains: (mouse over for more information) d1t13a_, d1t13c_, d1t13d_, d1t13e_ |