Lineage for d2htsa_ (2hts A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306133Family a.4.5.22: Heat-shock transcription factor [46873] (2 protein domains)
    automatically mapped to Pfam PF00447
  6. 2306134Protein Heat-shock transcription factor [46874] (2 species)
  7. 2306138Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [46876] (9 PDB entries)
  8. 2306139Domain d2htsa_: 2hts A: [16174]
    complexed with acy

Details for d2htsa_

PDB Entry: 2hts (more details), 1.83 Å

PDB Description: crystal structure of the dna binding domain of the heat shock transcription factor
PDB Compounds: (A:) heat-shock transcription factor

SCOPe Domain Sequences for d2htsa_:

Sequence, based on SEQRES records: (download)

>d2htsa_ a.4.5.22 (A:) Heat-shock transcription factor {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
arpafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrql
nmygwhkvqdvksgsmlsnndsrwefenerha

Sequence, based on observed residues (ATOM records): (download)

>d2htsa_ a.4.5.22 (A:) Heat-shock transcription factor {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
arpafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrql
nmygwhkvqdvksgsndsrwefenerha

SCOPe Domain Coordinates for d2htsa_:

Click to download the PDB-style file with coordinates for d2htsa_.
(The format of our PDB-style files is described here.)

Timeline for d2htsa_: