Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (147 species) not a true protein |
Species Streptomyces coelicolor [TaxId:100226] [188020] (1 PDB entry) |
Domain d1t00a_: 1t00 A: [161738] automated match to d1dbya_ |
PDB Entry: 1t00 (more details), 1.51 Å
SCOPe Domain Sequences for d1t00a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t00a_ c.47.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]} shmagtlkhvtddsfeqdvlkndkpvlvdfwaawcgpcrqiapsleaiaaeygdkieivk lnidenpgtaakygvmsiptlnvyqggevaktivgakpkaaivrdledfiad
Timeline for d1t00a_: