SCOPe 2.05: Domain d1t00a_: 1t00 A:

Lineage for d1t00a_ (1t00 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (147 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:100226] [188020] (1 PDB entry)

8. Domain d1t00a_: 1t00 A: [161738]
   automated match to d1dbya_

Details for d1t00a_

PDB Entry: 1t00, 1.51 Å

PDB Description: The structure of thioredoxin from S. coelicolor

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d1t00a_:

Sequence; same for both SEQRES and ATOM records:

>d1t00a_ c.47.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
shmagtlkhvtddsfeqdvlkndkpvlvdfwaawcgpcrqiapsleaiaaeygdkieivk
lnidenpgtaakygvmsiptlnvyqggevaktivgakpkaaivrdledfiad

Timeline for d1t00a_:

• d1t00a_ first appeared in SCOPe 2.01
  
• d1t00a_ appears in SCOPe 2.04
  
• d1t00a_ is called d1t00a1 in SCOPe 2.06
  
• d1t00a_ appears in the current release, SCOPe 2.08, called d1t00a1