Lineage for d1sykb_ (1syk B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2542663Protein cAMP-dependent PK, catalytic subunit [56116] (7 species)
    AGC group; PKA subfamily; serine/threonine kinase
  7. 2542709Species Mouse (Mus musculus) [TaxId:10090] [56119] (30 PDB entries)
  8. 2542740Domain d1sykb_: 1syk B: [161736]
    automated match to d1cmke_
    mutant

Details for d1sykb_

PDB Entry: 1syk (more details), 2.8 Å

PDB Description: crystal structure of e230q mutant of camp-dependent protein kinase reveals unexpected apoenzyme conformation
PDB Compounds: (B:) cAMP-dependent protein kinase, alpha-catalytic subunit

SCOPe Domain Sequences for d1sykb_:

Sequence, based on SEQRES records: (download)

>d1sykb_ d.144.1.7 (B:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]}
esvkeflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlvkhkesgnhyamk
ildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvaggemfshl
rrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvk
grtwtlcgtpeylapeiilskgynkavdwwalgvliyqmaagyppffadqpiqiyekivs
gkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkvea
pfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef

Sequence, based on observed residues (ATOM records): (download)

>d1sykb_ d.144.1.7 (B:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]}
esvkeflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlvkhkesgnhyamk
ildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvaggemfshl
rrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvk
grtwtlcgtpeylapeiilskgynkavdwwalgvliyqmaagyppffadqpiqiyekivs
gkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkvea
pfipkeeeeirvsinekcgkeftef

SCOPe Domain Coordinates for d1sykb_:

Click to download the PDB-style file with coordinates for d1sykb_.
(The format of our PDB-style files is described here.)

Timeline for d1sykb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1syka_