SCOPe 2.08: Domain d1syka_: 1syk A:

Lineage for d1syka_ (1syk A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein cAMP-dependent PK, catalytic subunit [56116] (7 species)
   AGC group; PKA subfamily; serine/threonine kinase

7. Species Mouse (Mus musculus) [TaxId:10090] [56119] (33 PDB entries)

8. Domain d1syka_: 1syk A: [161735]
   automated match to d1cmke_
   mutant

Details for d1syka_

PDB Entry: 1syk, 2.8 Å

PDB Description: crystal structure of e230q mutant of camp-dependent protein kinase reveals unexpected apoenzyme conformation

PDB Compounds: (A:) cAMP-dependent protein kinase, alpha-catalytic subunit

SCOPe Domain Sequences for d1syka_:

Sequence; same for both SEQRES and ATOM records:

>d1syka_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]}
gnaaaakkgseqesvkeflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlv
khkesgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
eyvaggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyqmaagyppffa
dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef

Timeline for d1syka_:

• d1syka_ first appeared in SCOPe 2.01
  
• d1syka_ appears in SCOPe 2.07